Placeholder image of a protein
Icon representing a puzzle

1210: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 23, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,722
  2. Avatar for It's over 9000! 12. It's over 9000! 4 pts. 8,662
  3. Avatar for BOINC@Poland 13. BOINC@Poland 3 pts. 8,638
  4. Avatar for xkcd 14. xkcd 2 pts. 8,637
  5. Avatar for freefolder 15. freefolder 1 pt. 8,564
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,558
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 8,549
  8. Avatar for Boinc.be 18. Boinc.be 1 pt. 8,538
  9. Avatar for Deleted group 19. Deleted group pts. 8,496
  10. Avatar for WSU Bioc Spring 2016 20. WSU Bioc Spring 2016 1 pt. 8,473
  1. Avatar for drumpeter18yrs9yrs 181. drumpeter18yrs9yrs Lv 1 1 pt. 8,451
  2. Avatar for Iamthed0t 182. Iamthed0t Lv 1 1 pt. 8,445
  3. Avatar for Brewston 183. Brewston Lv 1 1 pt. 8,445
  4. Avatar for khendarg 184. khendarg Lv 1 1 pt. 8,444
  5. Avatar for FelipeSMA 185. FelipeSMA Lv 1 1 pt. 8,440
  6. Avatar for jeliazkov 186. jeliazkov Lv 1 1 pt. 8,419
  7. Avatar for aspadistra 187. aspadistra Lv 1 1 pt. 8,417
  8. Avatar for Ronin-Sensei 188. Ronin-Sensei Lv 1 1 pt. 8,414
  9. Avatar for Chrisbe2 189. Chrisbe2 Lv 1 1 pt. 8,412
  10. Avatar for briemoney 190. briemoney Lv 1 1 pt. 8,411

Comments

jamiexq Lv 1

puzzle comments says there is one cys bond in this puzzle
I only see on cysteine in this puzzle, am I missing something? There is no way to form one cys bond here

Bletchley Park Lv 1

The secnd cys was possibly removed temporarily because of a bug in the client that causes crashes with cysteines.

bkoep Staff Lv 1

The original puzzle description was incorrect for this puzzle. I have amended the puzzle description.

There is only one cysteine in this protein, so no disulfides can form!