Placeholder image of a protein
Icon representing a puzzle

1210: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 23, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,722
  2. Avatar for It's over 9000! 12. It's over 9000! 4 pts. 8,662
  3. Avatar for BOINC@Poland 13. BOINC@Poland 3 pts. 8,638
  4. Avatar for xkcd 14. xkcd 2 pts. 8,637
  5. Avatar for freefolder 15. freefolder 1 pt. 8,564
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,558
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 8,549
  8. Avatar for Boinc.be 18. Boinc.be 1 pt. 8,538
  9. Avatar for Deleted group 19. Deleted group pts. 8,496
  10. Avatar for WSU Bioc Spring 2016 20. WSU Bioc Spring 2016 1 pt. 8,473
  1. Avatar for grogar7 11. grogar7 Lv 1 80 pts. 8,813
  2. Avatar for gmn 12. gmn Lv 1 78 pts. 8,813
  3. Avatar for nicobul 13. nicobul Lv 1 77 pts. 8,807
  4. Avatar for Mark- 14. Mark- Lv 1 75 pts. 8,805
  5. Avatar for Deleted player 15. Deleted player pts. 8,803
  6. Avatar for reefyrob 16. reefyrob Lv 1 71 pts. 8,799
  7. Avatar for johnmitch 17. johnmitch Lv 1 70 pts. 8,797
  8. Avatar for frood66 18. frood66 Lv 1 68 pts. 8,796
  9. Avatar for Blipperman 19. Blipperman Lv 1 66 pts. 8,788
  10. Avatar for gitwut 20. gitwut Lv 1 65 pts. 8,786

Comments

jamiexq Lv 1

puzzle comments says there is one cys bond in this puzzle
I only see on cysteine in this puzzle, am I missing something? There is no way to form one cys bond here

Bletchley Park Lv 1

The secnd cys was possibly removed temporarily because of a bug in the client that causes crashes with cysteines.

bkoep Staff Lv 1

The original puzzle description was incorrect for this puzzle. I have amended the puzzle description.

There is only one cysteine in this protein, so no disulfides can form!