Placeholder image of a protein
Icon representing a puzzle

1210: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
March 23, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,722
  2. Avatar for It's over 9000! 12. It's over 9000! 4 pts. 8,662
  3. Avatar for BOINC@Poland 13. BOINC@Poland 3 pts. 8,638
  4. Avatar for xkcd 14. xkcd 2 pts. 8,637
  5. Avatar for freefolder 15. freefolder 1 pt. 8,564
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,558
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 8,549
  8. Avatar for Boinc.be 18. Boinc.be 1 pt. 8,538
  9. Avatar for Deleted group 19. Deleted group pts. 8,496
  10. Avatar for WSU Bioc Spring 2016 20. WSU Bioc Spring 2016 1 pt. 8,473

  1. Avatar for Glen B 71. Glen B Lv 1 16 pts. 8,699
  2. Avatar for Bushman 72. Bushman Lv 1 16 pts. 8,696
  3. Avatar for SKSbell 73. SKSbell Lv 1 15 pts. 8,696
  4. Avatar for Mike Lewis 74. Mike Lewis Lv 1 15 pts. 8,693
  5. Avatar for ppp6 75. ppp6 Lv 1 14 pts. 8,690
  6. Avatar for dbuske 76. dbuske Lv 1 14 pts. 8,685
  7. Avatar for hansvandenhof 77. hansvandenhof Lv 1 13 pts. 8,683
  8. Avatar for manu8170 78. manu8170 Lv 1 13 pts. 8,682
  9. Avatar for hada 79. hada Lv 1 12 pts. 8,682
  10. Avatar for Marvelz 80. Marvelz Lv 1 12 pts. 8,680

Comments


jamiexq Lv 1

puzzle comments says there is one cys bond in this puzzle
I only see on cysteine in this puzzle, am I missing something? There is no way to form one cys bond here

Bletchley Park Lv 1

The secnd cys was possibly removed temporarily because of a bug in the client that causes crashes with cysteines.

bkoep Staff Lv 1

The original puzzle description was incorrect for this puzzle. I have amended the puzzle description.

There is only one cysteine in this protein, so no disulfides can form!