Placeholder image of a protein
Icon representing a puzzle

1210: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
March 23, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,722
  2. Avatar for It's over 9000! 12. It's over 9000! 4 pts. 8,662
  3. Avatar for BOINC@Poland 13. BOINC@Poland 3 pts. 8,638
  4. Avatar for xkcd 14. xkcd 2 pts. 8,637
  5. Avatar for freefolder 15. freefolder 1 pt. 8,564
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,558
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 8,549
  8. Avatar for Boinc.be 18. Boinc.be 1 pt. 8,538
  9. Avatar for Deleted group 19. Deleted group pts. 8,496
  10. Avatar for WSU Bioc Spring 2016 20. WSU Bioc Spring 2016 1 pt. 8,473

  1. Avatar for Deleted player 81. Deleted player pts. 8,679
  2. Avatar for Punktchen 82. Punktchen Lv 1 11 pts. 8,679
  3. Avatar for greepski 83. greepski Lv 1 11 pts. 8,678
  4. Avatar for alwen 84. alwen Lv 1 11 pts. 8,675
  5. Avatar for JUMELLE54 85. JUMELLE54 Lv 1 10 pts. 8,674
  6. Avatar for mitarcher 86. mitarcher Lv 1 10 pts. 8,672
  7. Avatar for stomjoh 87. stomjoh Lv 1 9 pts. 8,668
  8. Avatar for isaksson 88. isaksson Lv 1 9 pts. 8,663
  9. Avatar for BCAA 89. BCAA Lv 1 9 pts. 8,662
  10. Avatar for ManVsYard 90. ManVsYard Lv 1 9 pts. 8,661

Comments


jamiexq Lv 1

puzzle comments says there is one cys bond in this puzzle
I only see on cysteine in this puzzle, am I missing something? There is no way to form one cys bond here

Bletchley Park Lv 1

The secnd cys was possibly removed temporarily because of a bug in the client that causes crashes with cysteines.

bkoep Staff Lv 1

The original puzzle description was incorrect for this puzzle. I have amended the puzzle description.

There is only one cysteine in this protein, so no disulfides can form!