Placeholder image of a protein
Icon representing a puzzle

1210: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
March 23, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups


  1. Avatar for FoldIt@Netherlands 21. FoldIt@Netherlands 1 pt. 8,467
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 8,417
  3. Avatar for Deleted group 23. Deleted group pts. 8,405
  4. Avatar for Team South Africa 24. Team South Africa 1 pt. 8,286

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 8,912
  2. Avatar for mirp 2. mirp Lv 1 98 pts. 8,875
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 96 pts. 8,870
  4. Avatar for Timo van der Laan 4. Timo van der Laan Lv 1 94 pts. 8,854
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 92 pts. 8,852
  6. Avatar for Galaxie 6. Galaxie Lv 1 90 pts. 8,841
  7. Avatar for caglar 7. caglar Lv 1 88 pts. 8,832
  8. Avatar for Idiotboy 8. Idiotboy Lv 1 86 pts. 8,828
  9. Avatar for bertro 9. bertro Lv 1 84 pts. 8,826
  10. Avatar for pauldunn 10. pauldunn Lv 1 82 pts. 8,814

Comments


jamiexq Lv 1

puzzle comments says there is one cys bond in this puzzle
I only see on cysteine in this puzzle, am I missing something? There is no way to form one cys bond here

Bletchley Park Lv 1

The secnd cys was possibly removed temporarily because of a bug in the client that causes crashes with cysteines.

bkoep Staff Lv 1

The original puzzle description was incorrect for this puzzle. I have amended the puzzle description.

There is only one cysteine in this protein, so no disulfides can form!