Placeholder image of a protein
Icon representing a puzzle

1210: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 23, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups


  1. Avatar for Beta Folders 100 pts. 8,949
  2. Avatar for Go Science 2. Go Science 81 pts. 8,878
  3. Avatar for Void Crushers 3. Void Crushers 64 pts. 8,854
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 50 pts. 8,842
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 39 pts. 8,807
  6. Avatar for Contenders 6. Contenders 30 pts. 8,806
  7. Avatar for Gargleblasters 7. Gargleblasters 23 pts. 8,799
  8. Avatar for HMT heritage 8. HMT heritage 17 pts. 8,784
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 12 pts. 8,744
  10. Avatar for Russian team 10. Russian team 9 pts. 8,724

  1. Avatar for mirp 11. mirp Lv 1 20 pts. 8,863
  2. Avatar for penteplayer 12. penteplayer Lv 1 17 pts. 8,856
  3. Avatar for matosfran 13. matosfran Lv 1 14 pts. 8,850
  4. Avatar for Scopper 14. Scopper Lv 1 11 pts. 8,849
  5. Avatar for Galaxie 15. Galaxie Lv 1 9 pts. 8,842
  6. Avatar for gmn 16. gmn Lv 1 7 pts. 8,834
  7. Avatar for MaartenDesnouck 17. MaartenDesnouck Lv 1 6 pts. 8,833
  8. Avatar for lamoille 18. lamoille Lv 1 5 pts. 8,832
  9. Avatar for jamiexq 19. jamiexq Lv 1 4 pts. 8,831
  10. Avatar for jermainiac 20. jermainiac Lv 1 3 pts. 8,830

Comments


jamiexq Lv 1

puzzle comments says there is one cys bond in this puzzle
I only see on cysteine in this puzzle, am I missing something? There is no way to form one cys bond here

Bletchley Park Lv 1

The secnd cys was possibly removed temporarily because of a bug in the client that causes crashes with cysteines.

bkoep Staff Lv 1

The original puzzle description was incorrect for this puzzle. I have amended the puzzle description.

There is only one cysteine in this protein, so no disulfides can form!