Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 4 pts. 9,617
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 3 pts. 9,597
  3. Avatar for D001x Med Chem MOOC 13. D001x Med Chem MOOC 2 pts. 9,570
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 9,539
  5. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 9,493
  6. Avatar for Richard Dawkins Foundation 16. Richard Dawkins Foundation 1 pt. 9,199
  7. Avatar for Mojo Risin' 17. Mojo Risin' 1 pt. 9,185
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 9,136
  9. Avatar for Deleted group 19. Deleted group pts. 9,120
  10. Avatar for freefolder 20. freefolder 1 pt. 9,100
  1. Avatar for SamuelJackson
    1. SamuelJackson Lv 1
    100 pts. 9,815
  2. Avatar for actiasluna 2. actiasluna Lv 1 88 pts. 9,813
  3. Avatar for Galaxie 3. Galaxie Lv 1 76 pts. 9,810
  4. Avatar for ManVsYard 4. ManVsYard Lv 1 66 pts. 9,810
  5. Avatar for Blipperman 5. Blipperman Lv 1 57 pts. 9,808
  6. Avatar for smilingone 6. smilingone Lv 1 49 pts. 9,808
  7. Avatar for LociOiling 7. LociOiling Lv 1 42 pts. 9,807
  8. Avatar for reefyrob 8. reefyrob Lv 1 36 pts. 9,807
  9. Avatar for mirp 9. mirp Lv 1 30 pts. 9,804
  10. Avatar for packer 10. packer Lv 1 25 pts. 9,804

Comments