Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 4 pts. 9,617
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 3 pts. 9,597
  3. Avatar for D001x Med Chem MOOC 13. D001x Med Chem MOOC 2 pts. 9,570
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 9,539
  5. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 9,493
  6. Avatar for Richard Dawkins Foundation 16. Richard Dawkins Foundation 1 pt. 9,199
  7. Avatar for Mojo Risin' 17. Mojo Risin' 1 pt. 9,185
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 9,136
  9. Avatar for Deleted group 19. Deleted group pts. 9,120
  10. Avatar for freefolder 20. freefolder 1 pt. 9,100
  1. Avatar for isaksson 91. isaksson Lv 1 8 pts. 9,560
  2. Avatar for l3olo 92. l3olo Lv 1 8 pts. 9,560
  3. Avatar for sheerbliss 93. sheerbliss Lv 1 7 pts. 9,551
  4. Avatar for Qfast 94. Qfast Lv 1 7 pts. 9,549
  5. Avatar for Vinara 95. Vinara Lv 1 7 pts. 9,547
  6. Avatar for georg137 96. georg137 Lv 1 7 pts. 9,544
  7. Avatar for PrettyPony2001 97. PrettyPony2001 Lv 1 6 pts. 9,541
  8. Avatar for BCAA 98. BCAA Lv 1 6 pts. 9,539
  9. Avatar for Festering Wounds 99. Festering Wounds Lv 1 6 pts. 9,536
  10. Avatar for Pro Lapser 100. Pro Lapser Lv 1 6 pts. 9,534

Comments