Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 4 pts. 9,617
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 3 pts. 9,597
  3. Avatar for D001x Med Chem MOOC 13. D001x Med Chem MOOC 2 pts. 9,570
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 9,539
  5. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 9,493
  6. Avatar for Mojo Risin' 17. Mojo Risin' 1 pt. 9,185
  7. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 9,136
  8. Avatar for Deleted group 19. Deleted group pts. 9,120
  9. Avatar for freefolder 20. freefolder 1 pt. 9,100

  1. Avatar for gmn 11. gmn Lv 1 80 pts. 9,770
  2. Avatar for bertro 12. bertro Lv 1 78 pts. 9,756
  3. Avatar for grogar7 13. grogar7 Lv 1 76 pts. 9,748
  4. Avatar for O Seki To 14. O Seki To Lv 1 75 pts. 9,747
  5. Avatar for Deleted player 15. Deleted player 73 pts. 9,744
  6. Avatar for pauldunn 16. pauldunn Lv 1 71 pts. 9,740
  7. Avatar for johnmitch 17. johnmitch Lv 1 69 pts. 9,738
  8. Avatar for gloverd 18. gloverd Lv 1 68 pts. 9,736
  9. Avatar for Mark- 19. Mark- Lv 1 66 pts. 9,735
  10. Avatar for reefyrob 20. reefyrob Lv 1 65 pts. 9,725

Comments