Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 4 pts. 9,617
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 3 pts. 9,597
  3. Avatar for D001x Med Chem MOOC 13. D001x Med Chem MOOC 2 pts. 9,570
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 9,539
  5. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 9,493
  6. Avatar for Mojo Risin' 17. Mojo Risin' 1 pt. 9,185
  7. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 9,136
  8. Avatar for Deleted group 19. Deleted group pts. 9,120
  9. Avatar for freefolder 20. freefolder 1 pt. 9,100

  1. Avatar for SamuelJackson 31. SamuelJackson Lv 1 49 pts. 9,709
  2. Avatar for dcrwheeler 32. dcrwheeler Lv 1 48 pts. 9,700
  3. Avatar for Deleted player 33. Deleted player pts. 9,700
  4. Avatar for g_b 34. g_b Lv 1 45 pts. 9,696
  5. Avatar for Crossed Sticks 35. Crossed Sticks Lv 1 44 pts. 9,695
  6. Avatar for tallguy-13088 36. tallguy-13088 Lv 1 43 pts. 9,690
  7. Avatar for pvc78 37. pvc78 Lv 1 42 pts. 9,688
  8. Avatar for phi16 38. phi16 Lv 1 41 pts. 9,688
  9. Avatar for nicobul 39. nicobul Lv 1 40 pts. 9,686
  10. Avatar for joremen 40. joremen Lv 1 39 pts. 9,685

Comments