Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,037
  2. Avatar for SETI.Germany 22. SETI.Germany 1 pt. 8,286
  1. Avatar for retiredmichael
    1. retiredmichael Lv 1
    100 pts. 9,808
  2. Avatar for Galaxie 2. Galaxie Lv 1 98 pts. 9,806
  3. Avatar for mirp 3. mirp Lv 1 96 pts. 9,804
  4. Avatar for frood66 4. frood66 Lv 1 94 pts. 9,804
  5. Avatar for LociOiling 5. LociOiling Lv 1 92 pts. 9,793
  6. Avatar for KarenCH 6. KarenCH Lv 1 90 pts. 9,790
  7. Avatar for Scopper 7. Scopper Lv 1 88 pts. 9,780
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 86 pts. 9,776
  9. Avatar for gitwut 9. gitwut Lv 1 84 pts. 9,773
  10. Avatar for Timo van der Laan 10. Timo van der Laan Lv 1 82 pts. 9,772

Comments