Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,037
  2. Avatar for SETI.Germany 22. SETI.Germany 1 pt. 8,286
  1. Avatar for SamuelJackson
    1. SamuelJackson Lv 1
    100 pts. 9,815
  2. Avatar for actiasluna 2. actiasluna Lv 1 88 pts. 9,813
  3. Avatar for Galaxie 3. Galaxie Lv 1 76 pts. 9,810
  4. Avatar for ManVsYard 4. ManVsYard Lv 1 66 pts. 9,810
  5. Avatar for Blipperman 5. Blipperman Lv 1 57 pts. 9,808
  6. Avatar for smilingone 6. smilingone Lv 1 49 pts. 9,808
  7. Avatar for LociOiling 7. LociOiling Lv 1 42 pts. 9,807
  8. Avatar for reefyrob 8. reefyrob Lv 1 36 pts. 9,807
  9. Avatar for mirp 9. mirp Lv 1 30 pts. 9,804
  10. Avatar for packer 10. packer Lv 1 25 pts. 9,804

Comments