1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Summary

• Created: April 06, 2016
• Expires: April 13, 2016 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

• 1. Gargleblasters 100 pts. 9,815
• 2. Anthropic Dreams 79 pts. 9,810
• 3. Beta Folders 61 pts. 9,808
• 4. Go Science 47 pts. 9,804
• 5. Contenders 35 pts. 9,773
• 6. Void Crushers 26 pts. 9,772
• 7. HMT heritage 19 pts. 9,747
• 8. L'Alliance Francophone 14 pts. 9,724
• 9. Deleted group pts. 9,715
• 10. Italiani Al Lavoro 7 pts. 9,665

Top evolvers

• 11. lamoille 21 pts. 9,804
• 12. Deleted player 18 pts. 9,804
• 13. retiredmichael 15 pts. 9,803
• 14. pauldunn 12 pts. 9,803
• 15. Bruno Kestemont 10 pts. 9,800
• 16. Qfast 8 pts. 9,800
• 17. MaartenDesnouck 6 pts. 9,800
• 18. Norrjane 5 pts. 9,800
• 19. gmn 4 pts. 9,799
• 20. smholst 3 pts. 9,799