Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,815
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 79 pts. 9,810
  3. Avatar for Beta Folders 3. Beta Folders 61 pts. 9,808
  4. Avatar for Go Science 4. Go Science 47 pts. 9,804
  5. Avatar for Contenders 5. Contenders 35 pts. 9,773
  6. Avatar for Void Crushers 6. Void Crushers 26 pts. 9,772
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,747
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 9,724
  9. Avatar for Deleted group 9. Deleted group pts. 9,715
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 9,665

  1. Avatar for O Seki To 31. O Seki To Lv 1 1 pt. 9,742
  2. Avatar for mimi 32. mimi Lv 1 1 pt. 9,741
  3. Avatar for guineapig 33. guineapig Lv 1 1 pt. 9,654
  4. Avatar for ViJay7019 34. ViJay7019 Lv 1 1 pt. 9,643
  5. Avatar for andrewxc 35. andrewxc Lv 1 1 pt. 9,642
  6. Avatar for DodoBird 36. DodoBird Lv 1 1 pt. 9,626
  7. Avatar for Scopper 37. Scopper Lv 1 1 pt. 9,616
  8. Avatar for dbuske 38. dbuske Lv 1 1 pt. 9,485

Comments