1216: Revisiting Puzzle 146: Rosetta Decoy 9
Closed since about 10 years ago
Intermediate Intermediate Overall Overall Prediction PredictionSummary
- Created
- April 06, 2016
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK
Top groups
-
100 pts. 9,815
-
-
-
-
-
-
-
-
-