Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 5 pts. 8,396
  2. Avatar for DCC Folders 12. DCC Folders 4 pts. 8,320
  3. Avatar for D001x Med Chem MOOC 13. D001x Med Chem MOOC 2 pts. 8,245
  4. Avatar for CHNO Junkies 14. CHNO Junkies 2 pts. 7,910
  5. Avatar for WSU Bioc Spring 2016 15. WSU Bioc Spring 2016 1 pt. 7,818
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 7,779
  7. Avatar for Richard Dawkins Foundation 17. Richard Dawkins Foundation 1 pt. 7,766
  8. Avatar for It's over 9000! 18. It's over 9000! 1 pt. 7,317
  9. Avatar for Czech National Team 19. Czech National Team 1 pt. 6,645
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 5,950
  1. Avatar for arginia 101. arginia Lv 1 8 pts. 8,006
  2. Avatar for JMStiffler 102. JMStiffler Lv 1 8 pts. 8,004
  3. Avatar for Flagg65a 103. Flagg65a Lv 1 8 pts. 7,982
  4. Avatar for boondog 104. boondog Lv 1 8 pts. 7,979
  5. Avatar for NinjaGreg 105. NinjaGreg Lv 1 7 pts. 7,972
  6. Avatar for johngran 106. johngran Lv 1 7 pts. 7,965
  7. Avatar for t012 107. t012 Lv 1 7 pts. 7,954
  8. Avatar for smholst 108. smholst Lv 1 7 pts. 7,913
  9. Avatar for pmlkjn 109. pmlkjn Lv 1 7 pts. 7,910
  10. Avatar for 01010011111 110. 01010011111 Lv 1 6 pts. 7,903

Comments