Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 5 pts. 8,396
  2. Avatar for DCC Folders 12. DCC Folders 4 pts. 8,320
  3. Avatar for D001x Med Chem MOOC 13. D001x Med Chem MOOC 2 pts. 8,245
  4. Avatar for CHNO Junkies 14. CHNO Junkies 2 pts. 7,910
  5. Avatar for WSU Bioc Spring 2016 15. WSU Bioc Spring 2016 1 pt. 7,818
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 7,779
  7. Avatar for Richard Dawkins Foundation 17. Richard Dawkins Foundation 1 pt. 7,766
  8. Avatar for It's over 9000! 18. It's over 9000! 1 pt. 7,317
  9. Avatar for Czech National Team 19. Czech National Team 1 pt. 6,645
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 5,950
  1. Avatar for Sydefecks 161. Sydefecks Lv 1 1 pt. 7,034
  2. Avatar for dak3910 162. dak3910 Lv 1 1 pt. 7,021
  3. Avatar for Zivtins 163. Zivtins Lv 1 1 pt. 7,015
  4. Avatar for kodi4444 164. kodi4444 Lv 1 1 pt. 7,009
  5. Avatar for karost 165. karost Lv 1 1 pt. 6,878
  6. Avatar for cnhrcolemam 166. cnhrcolemam Lv 1 1 pt. 6,833
  7. Avatar for baleys15 167. baleys15 Lv 1 1 pt. 6,824
  8. Avatar for multaq 168. multaq Lv 1 1 pt. 6,787
  9. Avatar for GabrielFW 169. GabrielFW Lv 1 1 pt. 6,750
  10. Avatar for tabbycat10uk 170. tabbycat10uk Lv 1 1 pt. 6,719

Comments