Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 5 pts. 8,396
  2. Avatar for DCC Folders 12. DCC Folders 4 pts. 8,320
  3. Avatar for D001x Med Chem MOOC 13. D001x Med Chem MOOC 2 pts. 8,245
  4. Avatar for CHNO Junkies 14. CHNO Junkies 2 pts. 7,910
  5. Avatar for WSU Bioc Spring 2016 15. WSU Bioc Spring 2016 1 pt. 7,818
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 7,779
  7. Avatar for Richard Dawkins Foundation 17. Richard Dawkins Foundation 1 pt. 7,766
  8. Avatar for It's over 9000! 18. It's over 9000! 1 pt. 7,317
  9. Avatar for Czech National Team 19. Czech National Team 1 pt. 6,645
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 5,950
  1. Avatar for YorPrints 201. YorPrints Lv 1 1 pt. 5,161
  2. Avatar for lamoille 202. lamoille Lv 1 1 pt. 5,080
  3. Avatar for brooney6366 203. brooney6366 Lv 1 1 pt. 5,054
  4. Avatar for FreeFolder 204. FreeFolder Lv 1 1 pt. 5,030
  5. Avatar for tigerreye 205. tigerreye Lv 1 1 pt. 5,028
  6. Avatar for 341441 206. 341441 Lv 1 1 pt. 4,913
  7. Avatar for Inkedhands 207. Inkedhands Lv 1 1 pt. 4,887
  8. Avatar for bob123456789bob 208. bob123456789bob Lv 1 1 pt. 4,810
  9. Avatar for penteplayer 209. penteplayer Lv 1 1 pt. 4,719
  10. Avatar for zkm 210. zkm Lv 1 1 pt. 4,675

Comments