Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 5 pts. 8,396
  2. Avatar for DCC Folders 12. DCC Folders 4 pts. 8,320
  3. Avatar for D001x Med Chem MOOC 13. D001x Med Chem MOOC 2 pts. 8,245
  4. Avatar for CHNO Junkies 14. CHNO Junkies 2 pts. 7,910
  5. Avatar for WSU Bioc Spring 2016 15. WSU Bioc Spring 2016 1 pt. 7,818
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 7,779
  7. Avatar for Richard Dawkins Foundation 17. Richard Dawkins Foundation 1 pt. 7,766
  8. Avatar for It's over 9000! 18. It's over 9000! 1 pt. 7,317
  9. Avatar for Czech National Team 19. Czech National Team 1 pt. 6,645
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 5,950
  1. Avatar for Cbob 211. Cbob Lv 1 1 pt. 4,603
  2. Avatar for Codease 212. Codease Lv 1 1 pt. 4,489
  3. Avatar for Stephanix452 213. Stephanix452 Lv 1 1 pt. 4,485
  4. Avatar for fieldman 214. fieldman Lv 1 1 pt. 4,474
  5. Avatar for YumatovShow 215. YumatovShow Lv 1 1 pt. 4,473
  6. Avatar for briemoney 216. briemoney Lv 1 1 pt. 4,387
  7. Avatar for Psych0Active 217. Psych0Active Lv 1 1 pt. 4,382
  8. Avatar for gempetros 218. gempetros Lv 1 1 pt. 4,382
  9. Avatar for zack1998 219. zack1998 Lv 1 1 pt. 4,382
  10. Avatar for mirjamvandelft 220. mirjamvandelft Lv 1 1 pt. 4,301

Comments