Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 5 pts. 8,396
  2. Avatar for DCC Folders 12. DCC Folders 4 pts. 8,320
  3. Avatar for D001x Med Chem MOOC 13. D001x Med Chem MOOC 2 pts. 8,245
  4. Avatar for CHNO Junkies 14. CHNO Junkies 2 pts. 7,910
  5. Avatar for WSU Bioc Spring 2016 15. WSU Bioc Spring 2016 1 pt. 7,818
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 7,779
  7. Avatar for It's over 9000! 18. It's over 9000! 1 pt. 7,317
  8. Avatar for Czech National Team 19. Czech National Team 1 pt. 6,645
  9. Avatar for Team South Africa 20. Team South Africa 1 pt. 5,950

  1. Avatar for actiasluna 21. actiasluna Lv 1 67 pts. 8,866
  2. Avatar for Mark- 22. Mark- Lv 1 65 pts. 8,862
  3. Avatar for andrewxc 23. andrewxc Lv 1 64 pts. 8,843
  4. Avatar for Skippysk8s 24. Skippysk8s Lv 1 62 pts. 8,829
  5. Avatar for Bletchley Park 25. Bletchley Park Lv 1 61 pts. 8,812
  6. Avatar for bertro 26. bertro Lv 1 60 pts. 8,786
  7. Avatar for frood66 27. frood66 Lv 1 58 pts. 8,781
  8. Avatar for gloverd 28. gloverd Lv 1 57 pts. 8,761
  9. Avatar for Blipperman 29. Blipperman Lv 1 56 pts. 8,758
  10. Avatar for Glen B 30. Glen B Lv 1 55 pts. 8,754

Comments