Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 5 pts. 8,396
  2. Avatar for DCC Folders 12. DCC Folders 4 pts. 8,320
  3. Avatar for D001x Med Chem MOOC 13. D001x Med Chem MOOC 2 pts. 8,245
  4. Avatar for CHNO Junkies 14. CHNO Junkies 2 pts. 7,910
  5. Avatar for WSU Bioc Spring 2016 15. WSU Bioc Spring 2016 1 pt. 7,818
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 7,779
  7. Avatar for It's over 9000! 18. It's over 9000! 1 pt. 7,317
  8. Avatar for Czech National Team 19. Czech National Team 1 pt. 6,645
  9. Avatar for Team South Africa 20. Team South Africa 1 pt. 5,950

  1. Avatar for g_b 41. g_b Lv 1 42 pts. 8,664
  2. Avatar for Vinara 42. Vinara Lv 1 41 pts. 8,655
  3. Avatar for Mike Cassidy 43. Mike Cassidy Lv 1 41 pts. 8,649
  4. Avatar for spmm 44. spmm Lv 1 40 pts. 8,642
  5. Avatar for Deleted player 45. Deleted player pts. 8,629
  6. Avatar for joremen 46. joremen Lv 1 38 pts. 8,615
  7. Avatar for drumpeter18yrs9yrs 47. drumpeter18yrs9yrs Lv 1 37 pts. 8,587
  8. Avatar for smilingone 48. smilingone Lv 1 36 pts. 8,579
  9. Avatar for Mike Lewis 49. Mike Lewis Lv 1 35 pts. 8,559
  10. Avatar for phi16 50. phi16 Lv 1 34 pts. 8,556

Comments