Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 5 pts. 8,396
  2. Avatar for DCC Folders 12. DCC Folders 4 pts. 8,320
  3. Avatar for D001x Med Chem MOOC 13. D001x Med Chem MOOC 2 pts. 8,245
  4. Avatar for CHNO Junkies 14. CHNO Junkies 2 pts. 7,910
  5. Avatar for WSU Bioc Spring 2016 15. WSU Bioc Spring 2016 1 pt. 7,818
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 7,779
  7. Avatar for Richard Dawkins Foundation 17. Richard Dawkins Foundation 1 pt. 7,766
  8. Avatar for It's over 9000! 18. It's over 9000! 1 pt. 7,317
  9. Avatar for Czech National Team 19. Czech National Team 1 pt. 6,645
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 5,950
  1. Avatar for jobo0502 51. jobo0502 Lv 1 33 pts. 8,546
  2. Avatar for Anfinsen_slept_here 52. Anfinsen_slept_here Lv 1 33 pts. 8,541
  3. Avatar for yoyoparis 53. yoyoparis Lv 1 32 pts. 8,535
  4. Avatar for pvc78 54. pvc78 Lv 1 31 pts. 8,532
  5. Avatar for nemo7731 55. nemo7731 Lv 1 30 pts. 8,529
  6. Avatar for deLaCeiba 56. deLaCeiba Lv 1 30 pts. 8,519
  7. Avatar for WarpSpeed 57. WarpSpeed Lv 1 29 pts. 8,508
  8. Avatar for gurch 58. gurch Lv 1 28 pts. 8,505
  9. Avatar for jamiexq 59. jamiexq Lv 1 27 pts. 8,503
  10. Avatar for fishercat 60. fishercat Lv 1 27 pts. 8,500

Comments