Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 5,827
  2. Avatar for CH 150 class 22. CH 150 class 1 pt. 5,613
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 0
  1. Avatar for KarenCH
    1. KarenCH Lv 1
    100 pts. 9,179
  2. Avatar for Susume 2. Susume Lv 1 99 pts. 9,153
  3. Avatar for pmdpmd 3. pmdpmd Lv 1 97 pts. 9,106
  4. Avatar for grogar7 4. grogar7 Lv 1 95 pts. 9,093
  5. Avatar for gmn 5. gmn Lv 1 93 pts. 9,050
  6. Avatar for reefyrob 6. reefyrob Lv 1 91 pts. 9,037
  7. Avatar for mirp 7. mirp Lv 1 89 pts. 9,021
  8. Avatar for O Seki To 8. O Seki To Lv 1 87 pts. 9,020
  9. Avatar for Galaxie 9. Galaxie Lv 1 86 pts. 9,020
  10. Avatar for gitwut 10. gitwut Lv 1 84 pts. 9,006

Comments