Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,194
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 80 pts. 9,106
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,055
  4. Avatar for Go Science 4. Go Science 49 pts. 9,021
  5. Avatar for HMT heritage 5. HMT heritage 37 pts. 9,020
  6. Avatar for Contenders 6. Contenders 28 pts. 9,006
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 8,954
  8. Avatar for Gargleblasters 8. Gargleblasters 15 pts. 8,890
  9. Avatar for Deleted group 9. Deleted group pts. 8,587
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 8,519

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,194
  2. Avatar for lamoille 2. lamoille Lv 1 88 pts. 9,185
  3. Avatar for jamiexq 3. jamiexq Lv 1 77 pts. 9,173
  4. Avatar for MaartenDesnouck 4. MaartenDesnouck Lv 1 68 pts. 9,173
  5. Avatar for gdnskye 5. gdnskye Lv 1 59 pts. 9,170
  6. Avatar for phi16 6. phi16 Lv 1 51 pts. 9,170
  7. Avatar for gmn 7. gmn Lv 1 44 pts. 9,169
  8. Avatar for alwen 8. alwen Lv 1 38 pts. 9,167
  9. Avatar for MurloW 9. MurloW Lv 1 32 pts. 9,166
  10. Avatar for alcor29 10. alcor29 Lv 1 27 pts. 9,162

Comments