Placeholder image of a protein
Icon representing a puzzle

1219: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 6 pts. 9,843
  2. Avatar for It's over 9000! 12. It's over 9000! 4 pts. 9,703
  3. Avatar for D001x Med Chem MOOC 13. D001x Med Chem MOOC 3 pts. 9,699
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 9,663
  5. Avatar for foldeRNA 15. foldeRNA 1 pt. 9,559
  6. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 9,465
  7. Avatar for Czech National Team 18. Czech National Team 1 pt. 9,388
  8. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 9,371
  9. Avatar for Deleted group 20. Deleted group pts. 9,329

  1. Avatar for retiredmichael
    1. retiredmichael Lv 1
    100 pts. 10,220
  2. Avatar for smilingone 2. smilingone Lv 1 89 pts. 10,217
  3. Avatar for LociOiling 3. LociOiling Lv 1 78 pts. 10,217
  4. Avatar for reefyrob 4. reefyrob Lv 1 68 pts. 10,212
  5. Avatar for bertro 5. bertro Lv 1 60 pts. 10,179
  6. Avatar for Deleted player 6. Deleted player 52 pts. 10,166
  7. Avatar for Deleted player 7. Deleted player pts. 10,158
  8. Avatar for Galaxie 8. Galaxie Lv 1 39 pts. 10,129
  9. Avatar for gmn 9. gmn Lv 1 33 pts. 10,102
  10. Avatar for gitwut 10. gitwut Lv 1 28 pts. 10,101

Comments