Placeholder image of a protein
Icon representing a puzzle

1219: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 6 pts. 9,843
  2. Avatar for It's over 9000! 12. It's over 9000! 4 pts. 9,703
  3. Avatar for D001x Med Chem MOOC 13. D001x Med Chem MOOC 3 pts. 9,699
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 9,663
  5. Avatar for foldeRNA 15. foldeRNA 1 pt. 9,559
  6. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 9,465
  7. Avatar for Czech National Team 18. Czech National Team 1 pt. 9,388
  8. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 9,371
  9. Avatar for Deleted group 20. Deleted group pts. 9,329

  1. Avatar for NotJim99 181. NotJim99 Lv 1 1 pt. 9,336
  2. Avatar for tscarberry1 182. tscarberry1 Lv 1 1 pt. 9,329
  3. Avatar for pllq 183. pllq Lv 1 1 pt. 9,328
  4. Avatar for a87378165 184. a87378165 Lv 1 1 pt. 9,326
  5. Avatar for The_Lunar_1 185. The_Lunar_1 Lv 1 1 pt. 9,317
  6. Avatar for Jiri_Holzel_CZ 186. Jiri_Holzel_CZ Lv 1 1 pt. 9,313
  7. Avatar for PG231 187. PG231 Lv 1 1 pt. 9,306
  8. Avatar for AEJensen 188. AEJensen Lv 1 1 pt. 9,303
  9. Avatar for kyuheonre1024 189. kyuheonre1024 Lv 1 1 pt. 9,302
  10. Avatar for lfch 190. lfch Lv 1 1 pt. 9,288

Comments