Placeholder image of a protein
Icon representing a puzzle

1219: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 6 pts. 9,843
  2. Avatar for It's over 9000! 12. It's over 9000! 4 pts. 9,703
  3. Avatar for D001x Med Chem MOOC 13. D001x Med Chem MOOC 3 pts. 9,699
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 9,663
  5. Avatar for foldeRNA 15. foldeRNA 1 pt. 9,559
  6. Avatar for Richard Dawkins Foundation 16. Richard Dawkins Foundation 1 pt. 9,528
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 9,465
  8. Avatar for Czech National Team 18. Czech National Team 1 pt. 9,388
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 9,371
  10. Avatar for Deleted group 20. Deleted group pts. 9,329
  1. Avatar for Vinara 81. Vinara Lv 1 11 pts. 9,790
  2. Avatar for Superphosphate 82. Superphosphate Lv 1 11 pts. 9,788
  3. Avatar for eromana 83. eromana Lv 1 11 pts. 9,788
  4. Avatar for SouperGenious 84. SouperGenious Lv 1 10 pts. 9,787
  5. Avatar for manu8170 85. manu8170 Lv 1 10 pts. 9,783
  6. Avatar for JUMELLE54 86. JUMELLE54 Lv 1 10 pts. 9,775
  7. Avatar for ecali 87. ecali Lv 1 9 pts. 9,774
  8. Avatar for TastyMunchies 88. TastyMunchies Lv 1 9 pts. 9,760
  9. Avatar for ViJay7019 89. ViJay7019 Lv 1 9 pts. 9,759
  10. Avatar for Hollinas 90. Hollinas Lv 1 8 pts. 9,753

Comments