Placeholder image of a protein
Icon representing a puzzle

1219: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,285
  2. Avatar for SETI.Germany 22. SETI.Germany 1 pt. 9,228
  3. Avatar for FoldIt@Netherlands 23. FoldIt@Netherlands 1 pt. 8,338
  4. Avatar for DCC Folders 24. DCC Folders 1 pt. 8,338
  1. Avatar for nemo7731 131. nemo7731 Lv 1 2 pts. 9,643
  2. Avatar for TJOK fan 132. TJOK fan Lv 1 2 pts. 9,643
  3. Avatar for Mike Cassidy 133. Mike Cassidy Lv 1 2 pts. 9,637
  4. Avatar for ratqueen03 134. ratqueen03 Lv 1 2 pts. 9,628
  5. Avatar for Qfast 135. Qfast Lv 1 2 pts. 9,621
  6. Avatar for lamoille 136. lamoille Lv 1 1 pt. 9,594
  7. Avatar for sheerbliss 137. sheerbliss Lv 1 1 pt. 9,594
  8. Avatar for penteplayer 138. penteplayer Lv 1 1 pt. 9,588
  9. Avatar for phi16 139. phi16 Lv 1 1 pt. 9,587
  10. Avatar for Origami314 140. Origami314 Lv 1 1 pt. 9,587

Comments