Placeholder image of a protein
Icon representing a puzzle

1219: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,285
  2. Avatar for SETI.Germany 22. SETI.Germany 1 pt. 9,228
  3. Avatar for FoldIt@Netherlands 23. FoldIt@Netherlands 1 pt. 8,338
  4. Avatar for DCC Folders 24. DCC Folders 1 pt. 8,338
  1. Avatar for mirjamvandelft 161. mirjamvandelft Lv 1 1 pt. 9,450
  2. Avatar for boondog 162. boondog Lv 1 1 pt. 9,442
  3. Avatar for Radeodem8 163. Radeodem8 Lv 1 1 pt. 9,437
  4. Avatar for Sydefecks 164. Sydefecks Lv 1 1 pt. 9,436
  5. Avatar for Tac1 165. Tac1 Lv 1 1 pt. 9,436
  6. Avatar for rinze 166. rinze Lv 1 1 pt. 9,428
  7. Avatar for macht3 167. macht3 Lv 1 1 pt. 9,427
  8. Avatar for multaq 168. multaq Lv 1 1 pt. 9,415
  9. Avatar for Zivtins 169. Zivtins Lv 1 1 pt. 9,407
  10. Avatar for parsnip 170. parsnip Lv 1 1 pt. 9,406

Comments