Placeholder image of a protein
Icon representing a puzzle

1219: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,285
  2. Avatar for SETI.Germany 22. SETI.Germany 1 pt. 9,228
  3. Avatar for FoldIt@Netherlands 23. FoldIt@Netherlands 1 pt. 8,338
  4. Avatar for DCC Folders 24. DCC Folders 1 pt. 8,338
  1. Avatar for NotJim99 181. NotJim99 Lv 1 1 pt. 9,336
  2. Avatar for tscarberry1 182. tscarberry1 Lv 1 1 pt. 9,329
  3. Avatar for pllq 183. pllq Lv 1 1 pt. 9,328
  4. Avatar for a87378165 184. a87378165 Lv 1 1 pt. 9,326
  5. Avatar for The_Lunar_1 185. The_Lunar_1 Lv 1 1 pt. 9,317
  6. Avatar for Jiri_Holzel_CZ 186. Jiri_Holzel_CZ Lv 1 1 pt. 9,313
  7. Avatar for PG231 187. PG231 Lv 1 1 pt. 9,306
  8. Avatar for AEJensen 188. AEJensen Lv 1 1 pt. 9,303
  9. Avatar for kyuheonre1024 189. kyuheonre1024 Lv 1 1 pt. 9,302
  10. Avatar for lfch 190. lfch Lv 1 1 pt. 9,288

Comments