1219: Revisiting Puzzle 147: Rosetta Decoy 10
Closed since almost 10 years ago
Intermediate Intermediate Overall Overall Prediction PredictionSummary
- Created
- April 12, 2016
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL
