Placeholder image of a protein
Icon representing a puzzle

1219: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,285
  2. Avatar for SETI.Germany 22. SETI.Germany 1 pt. 9,228
  3. Avatar for FoldIt@Netherlands 23. FoldIt@Netherlands 1 pt. 8,338
  4. Avatar for DCC Folders 24. DCC Folders 1 pt. 8,338

  1. Avatar for cbwest 41. cbwest Lv 1 38 pts. 9,944
  2. Avatar for crpainter 42. crpainter Lv 1 37 pts. 9,943
  3. Avatar for caglar 43. caglar Lv 1 36 pts. 9,941
  4. Avatar for Satina 44. Satina Lv 1 35 pts. 9,940
  5. Avatar for Museka 45. Museka Lv 1 34 pts. 9,935
  6. Avatar for WarpSpeed 46. WarpSpeed Lv 1 33 pts. 9,933
  7. Avatar for christioanchauvin 47. christioanchauvin Lv 1 32 pts. 9,929
  8. Avatar for weitzen 48. weitzen Lv 1 31 pts. 9,929
  9. Avatar for cobaltteal 49. cobaltteal Lv 1 30 pts. 9,923
  10. Avatar for SKSbell 50. SKSbell Lv 1 30 pts. 9,922

Comments