Placeholder image of a protein
Icon representing a puzzle

1219: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,285
  2. Avatar for SETI.Germany 22. SETI.Germany 1 pt. 9,228
  3. Avatar for FoldIt@Netherlands 23. FoldIt@Netherlands 1 pt. 8,338
  4. Avatar for DCC Folders 24. DCC Folders 1 pt. 8,338
  1. Avatar for jobo0502 61. jobo0502 Lv 1 22 pts. 9,855
  2. Avatar for smholst 62. smholst Lv 1 21 pts. 9,848
  3. Avatar for stomjoh 63. stomjoh Lv 1 20 pts. 9,846
  4. Avatar for yoyoparis 64. yoyoparis Lv 1 20 pts. 9,845
  5. Avatar for Crossed Sticks 65. Crossed Sticks Lv 1 19 pts. 9,845
  6. Avatar for drumpeter18yrs9yrs 66. drumpeter18yrs9yrs Lv 1 19 pts. 9,843
  7. Avatar for Savagor 67. Savagor Lv 1 18 pts. 9,843
  8. Avatar for deLaCeiba 68. deLaCeiba Lv 1 17 pts. 9,843
  9. Avatar for isaksson 69. isaksson Lv 1 17 pts. 9,840
  10. Avatar for jamiexq 70. jamiexq Lv 1 16 pts. 9,839

Comments