Placeholder image of a protein
Icon representing a puzzle

1219: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,285
  2. Avatar for SETI.Germany 22. SETI.Germany 1 pt. 9,228
  3. Avatar for FoldIt@Netherlands 23. FoldIt@Netherlands 1 pt. 8,338
  4. Avatar for DCC Folders 24. DCC Folders 1 pt. 8,338
  1. Avatar for diamonddays 71. diamonddays Lv 1 16 pts. 9,839
  2. Avatar for hansvandenhof 72. hansvandenhof Lv 1 15 pts. 9,834
  3. Avatar for steveB 73. steveB Lv 1 15 pts. 9,834
  4. Avatar for Glen B 74. Glen B Lv 1 14 pts. 9,830
  5. Avatar for petetrig 75. petetrig Lv 1 14 pts. 9,819
  6. Avatar for arginia 76. arginia Lv 1 14 pts. 9,804
  7. Avatar for packer 77. packer Lv 1 13 pts. 9,802
  8. Avatar for Merf 78. Merf Lv 1 13 pts. 9,798
  9. Avatar for decbin 79. decbin Lv 1 12 pts. 9,796
  10. Avatar for pfirth 80. pfirth Lv 1 12 pts. 9,792

Comments