Placeholder image of a protein
Icon representing a puzzle

1219: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,285
  2. Avatar for SETI.Germany 22. SETI.Germany 1 pt. 9,228
  3. Avatar for FoldIt@Netherlands 23. FoldIt@Netherlands 1 pt. 8,338
  4. Avatar for DCC Folders 24. DCC Folders 1 pt. 8,338
  1. Avatar for Vinara 81. Vinara Lv 1 11 pts. 9,790
  2. Avatar for Superphosphate 82. Superphosphate Lv 1 11 pts. 9,788
  3. Avatar for eromana 83. eromana Lv 1 11 pts. 9,788
  4. Avatar for SouperGenious 84. SouperGenious Lv 1 10 pts. 9,787
  5. Avatar for manu8170 85. manu8170 Lv 1 10 pts. 9,783
  6. Avatar for JUMELLE54 86. JUMELLE54 Lv 1 10 pts. 9,775
  7. Avatar for ecali 87. ecali Lv 1 9 pts. 9,774
  8. Avatar for TastyMunchies 88. TastyMunchies Lv 1 9 pts. 9,760
  9. Avatar for ViJay7019 89. ViJay7019 Lv 1 9 pts. 9,759
  10. Avatar for Hollinas 90. Hollinas Lv 1 8 pts. 9,753

Comments