Placeholder image of a protein
Icon representing a puzzle

1219: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
April 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Beta Folders 100 pts. 10,220
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 81 pts. 10,131
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 64 pts. 10,113
  4. Avatar for Contenders 4. Contenders 50 pts. 10,104
  5. Avatar for Go Science 5. Go Science 39 pts. 10,102
  6. Avatar for Gargleblasters 6. Gargleblasters 30 pts. 10,086
  7. Avatar for Void Crushers 7. Void Crushers 23 pts. 10,048
  8. Avatar for HMT heritage 8. HMT heritage 17 pts. 10,010
  9. Avatar for BOINC@Poland 9. BOINC@Poland 12 pts. 9,999
  10. Avatar for Deleted group 10. Deleted group pts. 9,843

  1. Avatar for NotJim99 181. NotJim99 Lv 1 1 pt. 9,336
  2. Avatar for tscarberry1 182. tscarberry1 Lv 1 1 pt. 9,329
  3. Avatar for pllq 183. pllq Lv 1 1 pt. 9,328
  4. Avatar for a87378165 184. a87378165 Lv 1 1 pt. 9,326
  5. Avatar for The_Lunar_1 185. The_Lunar_1 Lv 1 1 pt. 9,317
  6. Avatar for Jiri_Holzel_CZ 186. Jiri_Holzel_CZ Lv 1 1 pt. 9,313
  7. Avatar for PG231 187. PG231 Lv 1 1 pt. 9,306
  8. Avatar for AEJensen 188. AEJensen Lv 1 1 pt. 9,303
  9. Avatar for kyuheonre1024 189. kyuheonre1024 Lv 1 1 pt. 9,302
  10. Avatar for lfch 190. lfch Lv 1 1 pt. 9,288

Comments