Placeholder image of a protein
Icon representing a puzzle

1219: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Beta Folders 100 pts. 10,220
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 81 pts. 10,131
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 64 pts. 10,113
  4. Avatar for Contenders 4. Contenders 50 pts. 10,104
  5. Avatar for Go Science 5. Go Science 39 pts. 10,102
  6. Avatar for Gargleblasters 6. Gargleblasters 30 pts. 10,086
  7. Avatar for Void Crushers 7. Void Crushers 23 pts. 10,048
  8. Avatar for HMT heritage 8. HMT heritage 17 pts. 10,010
  9. Avatar for BOINC@Poland 9. BOINC@Poland 12 pts. 9,999
  10. Avatar for Deleted group 10. Deleted group pts. 9,843

  1. Avatar for pandapharmd 111. pandapharmd Lv 1 4 pts. 9,701
  2. Avatar for Soggy Doglog 112. Soggy Doglog Lv 1 4 pts. 9,700
  3. Avatar for D001x_ErlandStevens 113. D001x_ErlandStevens Lv 1 4 pts. 9,699
  4. Avatar for NinjaGreg 114. NinjaGreg Lv 1 3 pts. 9,697
  5. Avatar for AeonFluff 115. AeonFluff Lv 1 3 pts. 9,697
  6. Avatar for NameChangeNeeded01 116. NameChangeNeeded01 Lv 1 3 pts. 9,693
  7. Avatar for 341441 117. 341441 Lv 1 3 pts. 9,691
  8. Avatar for tela 118. tela Lv 1 3 pts. 9,688
  9. Avatar for martinf 119. martinf Lv 1 3 pts. 9,687
  10. Avatar for hada 120. hada Lv 1 3 pts. 9,684

Comments