Placeholder image of a protein
Icon representing a puzzle

1222: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for It's over 9000! 11. It's over 9000! 5 pts. 9,195
  2. Avatar for Natural Abilities 12. Natural Abilities 4 pts. 9,187
  3. Avatar for BOINC@Poland 13. BOINC@Poland 2 pts. 9,149
  4. Avatar for D001x Med Chem MOOC 14. D001x Med Chem MOOC 2 pts. 9,117
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 9,015
  6. Avatar for TheBirds 16. TheBirds 1 pt. 8,974
  7. Avatar for CHNO Junkies 17. CHNO Junkies 1 pt. 8,958
  8. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 8,948
  9. Avatar for Deleted group 19. Deleted group pts. 8,793
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,576
  1. Avatar for TJOK fan 91. TJOK fan Lv 1 11 pts. 9,191
  2. Avatar for Mr_Jolty 92. Mr_Jolty Lv 1 11 pts. 9,187
  3. Avatar for pfirth 93. pfirth Lv 1 11 pts. 9,180
  4. Avatar for Truncheon Luncheon 94. Truncheon Luncheon Lv 1 10 pts. 9,179
  5. Avatar for PrettyPony2001 95. PrettyPony2001 Lv 1 10 pts. 9,179
  6. Avatar for Soggy Doglog 96. Soggy Doglog Lv 1 10 pts. 9,175
  7. Avatar for Ernst Zundel 97. Ernst Zundel Lv 1 9 pts. 9,162
  8. Avatar for pmthomson90 98. pmthomson90 Lv 1 9 pts. 9,160
  9. Avatar for joremen 99. joremen Lv 1 9 pts. 9,150
  10. Avatar for NameChangeNeeded01 100. NameChangeNeeded01 Lv 1 9 pts. 9,150

Comments