Placeholder image of a protein
Icon representing a puzzle

1222: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for It's over 9000! 11. It's over 9000! 5 pts. 9,195
  2. Avatar for Natural Abilities 12. Natural Abilities 4 pts. 9,187
  3. Avatar for BOINC@Poland 13. BOINC@Poland 2 pts. 9,149
  4. Avatar for D001x Med Chem MOOC 14. D001x Med Chem MOOC 2 pts. 9,117
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 9,015
  6. Avatar for TheBirds 16. TheBirds 1 pt. 8,974
  7. Avatar for CHNO Junkies 17. CHNO Junkies 1 pt. 8,958
  8. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 8,948
  9. Avatar for Deleted group 19. Deleted group pts. 8,793
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,576
  1. Avatar for kitek314_pl 101. kitek314_pl Lv 1 8 pts. 9,149
  2. Avatar for Origami314 102. Origami314 Lv 1 8 pts. 9,149
  3. Avatar for dbuske 103. dbuske Lv 1 8 pts. 9,143
  4. Avatar for Vinara 104. Vinara Lv 1 8 pts. 9,138
  5. Avatar for Hollinas 105. Hollinas Lv 1 7 pts. 9,134
  6. Avatar for arginia 106. arginia Lv 1 7 pts. 9,131
  7. Avatar for ViJay7019 107. ViJay7019 Lv 1 7 pts. 9,127
  8. Avatar for ratqueen03 108. ratqueen03 Lv 1 7 pts. 9,122
  9. Avatar for Punktchen 109. Punktchen Lv 1 7 pts. 9,119
  10. Avatar for Pro Lapser 110. Pro Lapser Lv 1 6 pts. 9,119

Comments