Placeholder image of a protein
Icon representing a puzzle

1222: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for It's over 9000! 11. It's over 9000! 5 pts. 9,195
  2. Avatar for Natural Abilities 12. Natural Abilities 4 pts. 9,187
  3. Avatar for BOINC@Poland 13. BOINC@Poland 2 pts. 9,149
  4. Avatar for D001x Med Chem MOOC 14. D001x Med Chem MOOC 2 pts. 9,117
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 9,015
  6. Avatar for TheBirds 16. TheBirds 1 pt. 8,974
  7. Avatar for CHNO Junkies 17. CHNO Junkies 1 pt. 8,958
  8. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 8,948
  9. Avatar for Deleted group 19. Deleted group pts. 8,793
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,576
  1. Avatar for PepperRed 181. PepperRed Lv 1 1 pt. 8,682
  2. Avatar for gurch 182. gurch Lv 1 1 pt. 8,677
  3. Avatar for Brightcroissant 183. Brightcroissant Lv 1 1 pt. 8,674
  4. Avatar for tscarberry1 184. tscarberry1 Lv 1 1 pt. 8,665
  5. Avatar for Sydefecks 185. Sydefecks Lv 1 1 pt. 8,663
  6. Avatar for Psych0Active 186. Psych0Active Lv 1 1 pt. 8,660
  7. Avatar for ivalnic 187. ivalnic Lv 1 1 pt. 8,656
  8. Avatar for RaeRae61 188. RaeRae61 Lv 1 1 pt. 8,654
  9. Avatar for Tac1 189. Tac1 Lv 1 1 pt. 8,645
  10. Avatar for parsnip 190. parsnip Lv 1 1 pt. 8,645

Comments