Placeholder image of a protein
Icon representing a puzzle

1222: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for It's over 9000! 11. It's over 9000! 5 pts. 9,195
  2. Avatar for Natural Abilities 12. Natural Abilities 4 pts. 9,187
  3. Avatar for BOINC@Poland 13. BOINC@Poland 2 pts. 9,149
  4. Avatar for D001x Med Chem MOOC 14. D001x Med Chem MOOC 2 pts. 9,117
  5. Avatar for TheBirds 16. TheBirds 1 pt. 8,974
  6. Avatar for CHNO Junkies 17. CHNO Junkies 1 pt. 8,958
  7. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 8,948
  8. Avatar for Deleted group 19. Deleted group pts. 8,793
  9. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,576

  1. Avatar for manu8170 71. manu8170 Lv 1 20 pts. 9,265
  2. Avatar for tallguy-13088 72. tallguy-13088 Lv 1 19 pts. 9,256
  3. Avatar for Mohambone 73. Mohambone Lv 1 19 pts. 9,244
  4. Avatar for deLaCeiba 74. deLaCeiba Lv 1 18 pts. 9,244
  5. Avatar for uihcv 75. uihcv Lv 1 18 pts. 9,242
  6. Avatar for phi16 76. phi16 Lv 1 17 pts. 9,242
  7. Avatar for Merf 77. Merf Lv 1 17 pts. 9,239
  8. Avatar for MaartenDesnouck 78. MaartenDesnouck Lv 1 17 pts. 9,229
  9. Avatar for cobaltteal 79. cobaltteal Lv 1 16 pts. 9,220
  10. Avatar for Jim Fraser 80. Jim Fraser Lv 1 16 pts. 9,220

Comments