Placeholder image of a protein
Icon representing a puzzle

1222: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 8,487
  2. Avatar for freefolder 22. freefolder 1 pt. 8,459
  3. Avatar for Window Group 23. Window Group 1 pt. 7,653

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,793
  2. Avatar for reefyrob 2. reefyrob Lv 1 87 pts. 9,787
  3. Avatar for smilingone 3. smilingone Lv 1 76 pts. 9,786
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 65 pts. 9,777
  5. Avatar for ManVsYard 5. ManVsYard Lv 1 56 pts. 9,738
  6. Avatar for actiasluna 6. actiasluna Lv 1 48 pts. 9,734
  7. Avatar for Skippysk8s 7. Skippysk8s Lv 1 41 pts. 9,732
  8. Avatar for Blipperman 8. Blipperman Lv 1 34 pts. 9,728
  9. Avatar for frood66 9. frood66 Lv 1 29 pts. 9,728
  10. Avatar for Mike Lewis 10. Mike Lewis Lv 1 24 pts. 9,726

Comments