Placeholder image of a protein
Icon representing a puzzle

1222: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 8,487
  2. Avatar for freefolder 22. freefolder 1 pt. 8,459
  3. Avatar for Window Group 23. Window Group 1 pt. 7,653

  1. Avatar for TJOK fan 91. TJOK fan Lv 1 11 pts. 9,191
  2. Avatar for Mr_Jolty 92. Mr_Jolty Lv 1 11 pts. 9,187
  3. Avatar for pfirth 93. pfirth Lv 1 11 pts. 9,180
  4. Avatar for Truncheon Luncheon 94. Truncheon Luncheon Lv 1 10 pts. 9,179
  5. Avatar for PrettyPony2001 95. PrettyPony2001 Lv 1 10 pts. 9,179
  6. Avatar for Soggy Doglog 96. Soggy Doglog Lv 1 10 pts. 9,175
  7. Avatar for Ernst Zundel 97. Ernst Zundel Lv 1 9 pts. 9,162
  8. Avatar for pmthomson90 98. pmthomson90 Lv 1 9 pts. 9,160
  9. Avatar for joremen 99. joremen Lv 1 9 pts. 9,150
  10. Avatar for NameChangeNeeded01 100. NameChangeNeeded01 Lv 1 9 pts. 9,150

Comments