Placeholder image of a protein
Icon representing a puzzle

1222: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 8,487
  2. Avatar for freefolder 22. freefolder 1 pt. 8,459
  3. Avatar for Window Group 23. Window Group 1 pt. 7,653

  1. Avatar for jvmm18 151. jvmm18 Lv 1 2 pts. 8,928
  2. Avatar for JMStiffler 152. JMStiffler Lv 1 2 pts. 8,914
  3. Avatar for redstorm45 153. redstorm45 Lv 1 1 pt. 8,910
  4. Avatar for Hiro Protagonist 154. Hiro Protagonist Lv 1 1 pt. 8,907
  5. Avatar for NotJim99 155. NotJim99 Lv 1 1 pt. 8,872
  6. Avatar for chrismen3 156. chrismen3 Lv 1 1 pt. 8,849
  7. Avatar for ace2787 157. ace2787 Lv 1 1 pt. 8,849
  8. Avatar for 01010011111 158. 01010011111 Lv 1 1 pt. 8,841
  9. Avatar for justjustin 159. justjustin Lv 1 1 pt. 8,827
  10. Avatar for lamoille 160. lamoille Lv 1 1 pt. 8,821

Comments