Placeholder image of a protein
Icon representing a puzzle

1222: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 8,487
  2. Avatar for freefolder 22. freefolder 1 pt. 8,459
  3. Avatar for Window Group 23. Window Group 1 pt. 7,653
  1. Avatar for Mike Cassidy 161. Mike Cassidy Lv 1 1 pt. 8,807
  2. Avatar for lynnai 162. lynnai Lv 1 1 pt. 8,799
  3. Avatar for Graham MF 163. Graham MF Lv 1 1 pt. 8,798
  4. Avatar for stephany44095 164. stephany44095 Lv 1 1 pt. 8,793
  5. Avatar for Pietro MSB 165. Pietro MSB Lv 1 1 pt. 8,789
  6. Avatar for senor pit 166. senor pit Lv 1 1 pt. 8,783
  7. Avatar for Flagg65a 167. Flagg65a Lv 1 1 pt. 8,772
  8. Avatar for dahast.de 168. dahast.de Lv 1 1 pt. 8,763
  9. Avatar for boondog 169. boondog Lv 1 1 pt. 8,760
  10. Avatar for navn 170. navn Lv 1 1 pt. 8,750

Comments