Placeholder image of a protein
Icon representing a puzzle

1222: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 8,487
  2. Avatar for freefolder 22. freefolder 1 pt. 8,459
  3. Avatar for Window Group 23. Window Group 1 pt. 7,653

  1. Avatar for ferzle 171. ferzle Lv 1 1 pt. 8,744
  2. Avatar for placid.lion 172. placid.lion Lv 1 1 pt. 8,743
  3. Avatar for rinze 173. rinze Lv 1 1 pt. 8,736
  4. Avatar for multaq 174. multaq Lv 1 1 pt. 8,722
  5. Avatar for DScott 175. DScott Lv 1 1 pt. 8,718
  6. Avatar for Iron pet 176. Iron pet Lv 1 1 pt. 8,712
  7. Avatar for redguy 177. redguy Lv 1 1 pt. 8,711
  8. Avatar for poiuyqwert 178. poiuyqwert Lv 1 1 pt. 8,704
  9. Avatar for xplocast1 179. xplocast1 Lv 1 1 pt. 8,686
  10. Avatar for lockert 180. lockert Lv 1 1 pt. 8,682

Comments