Placeholder image of a protein
Icon representing a puzzle

1222: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 8,487
  2. Avatar for freefolder 22. freefolder 1 pt. 8,459
  3. Avatar for Window Group 23. Window Group 1 pt. 7,653
  1. Avatar for PepperRed 181. PepperRed Lv 1 1 pt. 8,682
  2. Avatar for gurch 182. gurch Lv 1 1 pt. 8,677
  3. Avatar for Brightcroissant 183. Brightcroissant Lv 1 1 pt. 8,674
  4. Avatar for tscarberry1 184. tscarberry1 Lv 1 1 pt. 8,665
  5. Avatar for Sydefecks 185. Sydefecks Lv 1 1 pt. 8,663
  6. Avatar for Psych0Active 186. Psych0Active Lv 1 1 pt. 8,660
  7. Avatar for ivalnic 187. ivalnic Lv 1 1 pt. 8,656
  8. Avatar for RaeRae61 188. RaeRae61 Lv 1 1 pt. 8,654
  9. Avatar for Tac1 189. Tac1 Lv 1 1 pt. 8,645
  10. Avatar for parsnip 190. parsnip Lv 1 1 pt. 8,645

Comments