Placeholder image of a protein
Icon representing a puzzle

1222: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 8,487
  2. Avatar for freefolder 22. freefolder 1 pt. 8,459
  3. Avatar for Window Group 23. Window Group 1 pt. 7,653

  1. Avatar for Bletchley Park 11. Bletchley Park Lv 1 82 pts. 9,642
  2. Avatar for actiasluna 12. actiasluna Lv 1 80 pts. 9,640
  3. Avatar for grogar7 13. grogar7 Lv 1 79 pts. 9,640
  4. Avatar for Deleted player 14. Deleted player pts. 9,639
  5. Avatar for gloverd 15. gloverd Lv 1 76 pts. 9,635
  6. Avatar for frood66 16. frood66 Lv 1 74 pts. 9,632
  7. Avatar for bendbob 17. bendbob Lv 1 72 pts. 9,630
  8. Avatar for Timo van der Laan 18. Timo van der Laan Lv 1 71 pts. 9,620
  9. Avatar for Blipperman 19. Blipperman Lv 1 69 pts. 9,614
  10. Avatar for nicobul 20. nicobul Lv 1 68 pts. 9,611

Comments