Placeholder image of a protein
Icon representing a puzzle

1222: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 8,487
  2. Avatar for freefolder 22. freefolder 1 pt. 8,459
  3. Avatar for Window Group 23. Window Group 1 pt. 7,653
  1. Avatar for Chinotauku 221. Chinotauku Lv 1 1 pt. 8,485
  2. Avatar for bhodg1 222. bhodg1 Lv 1 1 pt. 8,484
  3. Avatar for kaiizer07 223. kaiizer07 Lv 1 1 pt. 8,483
  4. Avatar for flojoe83 224. flojoe83 Lv 1 1 pt. 8,472
  5. Avatar for Altercomp 225. Altercomp Lv 1 1 pt. 8,459
  6. Avatar for joydoong 226. joydoong Lv 1 1 pt. 8,459
  7. Avatar for SadertdinovRamazan 227. SadertdinovRamazan Lv 1 1 pt. 8,425
  8. Avatar for Rene Matjanec 228. Rene Matjanec Lv 1 1 pt. 8,414
  9. Avatar for Mokdang 229. Mokdang Lv 1 1 pt. 8,331
  10. Avatar for LeSalowpiot 230. LeSalowpiot Lv 1 1 pt. 8,267

Comments