Placeholder image of a protein
Icon representing a puzzle

1222: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 8,487
  2. Avatar for freefolder 22. freefolder 1 pt. 8,459
  3. Avatar for Window Group 23. Window Group 1 pt. 7,653

  1. Avatar for molecularsoup 231. molecularsoup Lv 1 1 pt. 8,133
  2. Avatar for RaDojka 232. RaDojka Lv 1 1 pt. 8,075
  3. Avatar for ScaryGerms 233. ScaryGerms Lv 1 1 pt. 7,873
  4. Avatar for me357 234. me357 Lv 1 1 pt. 7,870
  5. Avatar for Asthmagicisn 235. Asthmagicisn Lv 1 1 pt. 7,866
  6. Avatar for trebach 236. trebach Lv 1 1 pt. 7,854
  7. Avatar for uitham 237. uitham Lv 1 1 pt. 7,777
  8. Avatar for laura.skala 238. laura.skala Lv 1 1 pt. 7,767
  9. Avatar for inkycatz 239. inkycatz Lv 1 1 pt. 7,674
  10. Avatar for jflat06 240. jflat06 Lv 1 1 pt. 7,653

Comments